PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.3G274800.1.p
Common NamePRUPE_ppa015976mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB
Protein Properties Length: 372aa    MW: 40669.4 Da    PI: 6.3861
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.3G274800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.22.9e-161461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg WT+ Ed +l+ ++ ++G g+W++++++ g++R++k+c++rw +yl
  Prupe.3G274800.1.p 14 RGIWTAAEDAKLLAYISKHGVGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                        788*******************************************97 PP

2Myb_DNA-binding47.63.8e-1569110346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++T++E+e ++++++  G++ W++Ia+ ++ gRt++++k++w++
  Prupe.3G274800.1.p  69 SFTPQEEEHIINLHEAIGSR-WSLIAKLLP-GRTDNDVKNYWNT 110
                         79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-23564IPR009057Homeodomain-like
PROSITE profilePS5129424.968965IPR017930Myb domain
SuperFamilySSF466894.69E-3111108IPR009057Homeodomain-like
SMARTSM007171.1E-141363IPR001005SANT/Myb domain
PfamPF002491.1E-141461IPR001005SANT/Myb domain
CDDcd001676.28E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2365116IPR009057Homeodomain-like
PROSITE profilePS5129416.48266116IPR017930Myb domain
SMARTSM007172.3E-1266114IPR001005SANT/Myb domain
CDDcd001674.09E-1069112No hitNo description
PfamPF002491.1E-1369110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGIWTAA EDAKLLAYIS KHGVGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLIHDSF TPQEEEHIIN LHEAIGSRWS LIAKLLPGRT DNDVKNYWNT KLKKKLSKMG  120
IDPVTHKPFS QILSDYGNIS SLPSIDNQFG SFLKNLNNTF VPKSEPSSGI TGLPLGVNTY  180
SNMMMNPIGS DNSTASTLSL GIVAQFQEIN QDSVQVQPHF LNEVASSCSS SSPPHATDHQ  240
LSSQPTYLCQ QSHHEAQITP SSSFNWSEFL LHEPFSSADE LKQEQDFHGT MMSSSSALPT  300
LAGGSEHNLK ATTQACDFGS SAINIGGQRN NNLAHDQASS SSMTSFVDTI LGQDSEMQAA  360
FPELLDASFD Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007217774.10.0hypothetical protein PRUPE_ppa015976mg
TrEMBLM5XBU20.0M5XBU2_PRUPE; Uncharacterized protein
STRINGVIT_14s0066g02180.t011e-128(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.13e-83MYB family protein